Protein sequence manipulation for adding elements before or after the sequence.

1 view (last 30 days)
how do i add zeros to both ends or one end (before or after) of a protein sequence?
Example:
a protein sequence is given as 'ITYTDCTESGQDLCLCEGSDVCGKGNKCILGSNGEENQCVTGEGTPKPQSHNDGDFEEIPEEYLQ'
how do i add zeros at the beginning before the first element of the sequence?

Accepted Answer

Peng Li
Peng Li on 31 Mar 2020
The easiest way to add N zeros before it can be done by:
[repmat('0', 1, N) yourProSeq];
  5 Comments

Sign in to comment.

More Answers (0)

Community Treasure Hunt

Find the treasures in MATLAB Central and discover how the community can help you!

Start Hunting!

Translated by